PDB entry 2vnu

View 2vnu on RCSB PDB site
Description: crystal structure of sc rrp44
Class: hydrolase/RNA
Keywords: hydrolase-RNA complex, RNA degradation, RNA-binding, RNA processing
Deposited on 2008-02-07, released 2008-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: 5'-r(*ap*ap*ap*ap*ap*ap*ap*ap*ap*ap)-3'
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
  • Chain 'D':
    Compound: exosome complex exonuclease rrp44
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08162
      • engineered mutation (309)
    Domains in SCOPe 2.05: d2vnud1, d2vnud2, d2vnud3, d2vnud4
  • Heterogens: MG, NA, 1PE, HOH

PDB Chain Sequences:

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vnuD (D:)
    dkdlerdtfsdftfpeyystarvmgglkngvlyqgniqiseynflegsvslprfskpvli
    vgqknlnrafngdqvivellpqsewkapssivldsehfdvndnpdieagddddnnesssn
    ttvisdkqrrllakdamiaqrskkiqptakvvyiqrrswrqyvgqlapssvdpqssstqn
    vfvilmdkclpkvrirtrraaelldkrivisidswptthkyplghfvrdlgtiesaqaet
    ealllehdveyrpfskkvleclpaeghdwkaptklddpeavskdplltkrkdlrdklics
    idppgcvdindalhakklpngnwevgvhiadvthfvkpgtaldaegaargtsvylvdkri
    dmlpmllgtdlcslkpyvdrfafsviwelddsanivnvnfmksvirsreafsyeqaqlri
    ddktqndeltmgmrallklsvklkqkrleagalnlaspevkvhmdsetsdpneveikkll
    atnslveefmllanisvarkiydafpqtamlrrhaappstnfeilnemlntrknmsisle
    sskaladsldrcvdpedpyfntlvrimstrcmmaaqyfysgaysypdfrhyglavdiyth
    ftspirrycdvvahrqlagaigyeplslthrdknkmdmicrninrkhrnaqfagrasiey
    yvgqvmrnnestetgyvikvfnngivvlvpkfgveglirldnltedpnsaafdeveyklt
    fvptnsdkprdvyvfdkvevqvrsvmdpitskrkaelllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vnuD (D:)
    dftfpeyystarvmgglkngvlyqgniqiseynflegsvslprfskpvlivgqknlnraf
    ngdqvivellpqsewkapssivldsehfdiqptakvvyiqrrswrqyvgqlapssvdpqs
    sstqnvfvilmdkclpkvrirtrraaelldkrivisidswptthkyplghfvrdlgties
    aqaetealllehdveyrpfskkvleclpaeghdwkaptklddpeavskdplltkrkdlrd
    klicsidppgcvdindalhakklpngnwevgvhiadvthfvkpgtaldaegaargtsvyl
    vdkridmlpmllgtdlcslkpyvdrfafsviwelddsanivnvnfmksvirsreafsyeq
    aqlriddktqndeltmgmrallklsvklkqkrleagalnlaspevkvhmdsetsdpneve
    ikkllatnslveefmllanisvarkiydafpqtamlrrhaappstnfeilnemlntrknm
    sislesskaladsldrcvdpedpyfntlvrimstrcmmaaqyfysgaysypdfrhyglav
    diythftspirrycdvvahrqlagaigyeplslthrdknkmdmicrninrkhrnaqfagr
    asieyyvgqvmrnnestetgyvikvfnngivvlvpkfgveglirldnltedpnsaafdev
    eykltfvptnsdkprdvyvfdkvevqvrkrkael