PDB entry 2vnr

View 2vnr on RCSB PDB site
Description: family 51 carbohydrate binding module from a family 98 glycoside hydrolase produced by clostridium perfringens.
Class: hydrolase
Keywords: family 51 carbohydrate binding module, family 98 glycoside hydrolase, clostridium perfringens, hydrolase
Deposited on 2008-02-06, released 2008-02-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.199
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cpe0329
    Species: Clostridium perfringens [TaxId:1502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vnra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vnrA (A:)
evyaleesrdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsise
fekglgtiagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviy
stinqfpngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfvn

    Sequence, based on observed residues (ATOM records): (download) 
    >2vnrA (A:)
srdvylsdldwlnathgddtkskivqknhpftpgnnnqstkislkmedgsisefekglgt
iagspstitydisgagvtkffsylgidrsanpineqyakvdkievvvdgkviystinqfp
ngltyetpaikvdlnipenakrlqlksyagektwgdevvyadakftakgdfvn