PDB entry 2vnl

View 2vnl on RCSB PDB site
Description: mutant y108wdel of the headbinding domain of phage p22 tailspike c- terminally fused to isoleucine zipper piigcn4 (chimera ii)
Deposited on 2008-02-05, released 2009-02-10
The last revision was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional tail protein, piigcn4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12528 (Start-120)
      • engineered mutation (107)
    • PDB 2VNL (121-149)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2vnlA (A:)
    tditanvvvsnprpiftesrsfkavangkiyigqidtdpvnpanqipvyienedgshvqi
    tqpliinaagkivyngqlvkivtvqghsmaiydangsqvdyianvlkwdpdqysieadkk
    fkqiedkieeilskiyhieneiarikklige
    

    Sequence, based on observed residues (ATOM records):
    >2vnlA (A:)
    tanvvvsnprpiftesrsfkavangkiyigqidtdpvnpanqipvyienedgshvqitqp
    liinaagkivyngqlvkivtvqghsmaiydangsqvdyianvlkwdpdqysieadkkfkq
    iedkieeilskiyhieneiarikklig