PDB entry 2vnf

View 2vnf on RCSB PDB site
Description: molecular basis of histone h3k4me3 recognition by ing4
Class: cell cycle
Keywords: acetylation, alternative splicing, anti-oncogene, cell cycle, coiled c nucleus, zinc, zinc-finger, ing4, phd finger, histone 3
Deposited on 2008-02-04, released 2008-04-01
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-17, with a file datestamp of 2008-06-13.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.15971
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vnfa1
  • Chain 'B':
    Compound: peptide
  • Chain 'C':
    Compound: Inhibitor of growth protein 4
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vnfc1
  • Chain 'D':
    Compound: peptide
  • Heterogens: NA, ZN, DTT, M3L, DTU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vnfA (A:)
mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer

    Sequence, based on observed residues (ATOM records): (download) 
    >2vnfA (A:)
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2vnfC (C:)
mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer

    Sequence, based on observed residues (ATOM records): (download) 
    >2vnfC (C:)
vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

  • Chain 'D':
    No sequence available.