PDB entry 2vnf
View 2vnf on RCSB PDB site
Description: molecular basis of histone h3k4me3 recognition by ing4
Class: cell cycle
Keywords: anti-oncogene, cell cycle, coiled c nucleus, zinc-finger, ing4, phd finger, histone 3
Deposited on
2008-02-04, released
2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2016-12-28, with a file datestamp of
2016-12-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Inhibitor of growth protein 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2vnfa_ - Chain 'B':
Compound: histone h3
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Inhibitor of growth protein 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2vnfc_ - Chain 'D':
Compound: histone h3
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Heterogens: NA, DTT, ZN, DTU, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2vnfA (A:)
mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
Sequence, based on observed residues (ATOM records): (download)
>2vnfA (A:)
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2vnfC (C:)
mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
Sequence, based on observed residues (ATOM records): (download)
>2vnfC (C:)
vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
- Chain 'D':
No sequence available.