PDB entry 2vnf

View 2vnf on RCSB PDB site
Description: molecular basis of histone h3k4me3 recognition by ing4
Class: cell cycle
Keywords: anti-oncogene, cell cycle, coiled c nucleus, zinc-finger, ing4, phd finger, histone 3
Deposited on 2008-02-04, released 2008-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Inhibitor of growth protein 4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNL4
  Domains in SCOPe 2.08: d2vnfa_
• Chain 'B':
  Compound: histone h3
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6 (0-End)
• Chain 'C':
  Compound: Inhibitor of growth protein 4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UNL4
  Domains in SCOPe 2.08: d2vnfc_
• Chain 'D':
  Compound: histone h3
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5TEC6 (0-9)
• Heterogens: NA, DTT, ZN, DTU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2vnfA (A:)
  mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vnfA (A:)
  eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2vnfC (C:)
  mdmpvdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vnfC (C:)
  vdpneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq
  

  
  
• Chain 'D':
  No sequence available.