PDB entry 2vmr

View 2vmr on RCSB PDB site
Description: crystal structure of y60absshmt internal aldimine
Class: transferase
Keywords: plp-dependent enzymes, serine hydroxymethyltransferase, y60a, shmt, transferase, folate binding, pyridoxal phosphate, one-carbon metabolism
Deposited on 2008-01-29, released 2008-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine hydroxymethyltransferase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SIB6 (0-404)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d2vmra_
  • Heterogens: PLP, MRD, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmrA (A:)
    mkylpqqdpqvfaaieqerkrqhakieliasenfvsravmeaqgsvltnkyaegypgrra
    yggceyvdiveelarerakqlfgaehanvqphsgaqanmavyftvlehgdtvlgmnlshg
    ghlthgspvnfsgvqynfvaygvdpethvidyddvrekarlhrpklivaaasaypriidf
    akfreiadevgaylmvdmahiaglvaaglhpnpvpyahfvtttthktlrgprggmilcqe
    qfakqidkaifpgiqggplmhviaakavafgealqddfkayakrvvdnakrlasalqneg
    ftlvsggtdnhlllvdlrpqqltgktaekvldevgitvnkntipydpespfvtsgirigt
    aavttrgfgleemdeiaaiiglvlknvgseqaleearqrvaaltd