PDB entry 2vml

View 2vml on RCSB PDB site
Description: the monoclinic structure of phycocyanin from gloeobacter violaceus
Class: photosynthesis
Keywords: photosynthesis, light-harvesting, electron transport, transport, chromophore, bile pigment, phycobilisome
Deposited on 2008-01-28, released 2008-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmla_
  • Chain 'B':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlb_
  • Chain 'C':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlc_
  • Chain 'D':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmld_
  • Chain 'E':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmle_
  • Chain 'F':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlf_
  • Chain 'G':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlg_
  • Chain 'H':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlh_
  • Chain 'I':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmli_
  • Chain 'J':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlj_
  • Chain 'K':
    Compound: phycocyanin alpha chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmlk_
  • Chain 'L':
    Compound: phycocyanin beta chain
    Species: GLOEOBACTER VIOLACEUS [TaxId:33072]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vmll_
  • Heterogens: CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlA (A:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlB (B:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlC (C:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlD (D:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlE (E:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlF (F:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlG (G:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlH (H:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlI (I:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlJ (J:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlK (K:)
    mktviteviasadsqgrflnntelqaangrfqratasmeaaraltsnadslvkgavqevy
    nkfpyltqpgqmgygdtnqakcardishylrfityslvaggtgplddyivaglrevnrtf
    nlspswyiealkhikgkvgsqlsgqplteanayidycinals
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vmlL (L:)
    mqdaftkaivaadlrgsflseqelnqltnlvkesnkrldavnaitgnaaeiisdaahklf
    aeqtdlirpggnaypnrrmaaclrdmeiilryvsyallagdasvledrclnglketyval
    gtptrsvaravqlmketaigyvnspsgvtrgdcsalvneaatyfdkaaasia