PDB entry 2vm6

View 2vm6 on RCSB PDB site
Description: Human Bcl2-A1 in complex with Bim-BH3 peptide
Class: immune system
Keywords: b-cell lymphoma2, antiapoptotic, immune system, bim, bfl-1, bcl2a1, bcl-2a1, membrane, apoptosis
Deposited on 2008-01-23, released 2008-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2-related protein a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VM6 (0-0)
    • Uniprot Q16548 (1-149)
    Domains in SCOPe 2.08: d2vm6a1, d2vm6a2
  • Chain 'B':
    Compound: Bcl-2-like protein 11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vm6A (A:)
smtdcefgyiyrlaqdylqcvlqipqpgsgpsktsrvlqnvafsvqkeveknlkscldnv
nvvsvdtartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeis
yfvaefimnntgewirqnggwengfvkkfe

    Sequence, based on observed residues (ATOM records): (download) 
    >2vm6A (A:)
smtdcefgyiyrlaqdylqcvlqipsktsrvlqnvafsvqkeveknlkscldnvnvvsvd
tartlfnqvmekefedgiinwgrivtifafegilikkllrqqiapdvdtykeisyfvaef
imnntgewirqnggwengfvkkfe

  • Chain 'B':
    No sequence available.