PDB entry 2vm5

View 2vm5 on RCSB PDB site
Description: human bir2 domain of baculoviral inhibitor of apoptosis repeat- containing 1 (birc1)
Class: apoptosis
Keywords: apoptosis
Deposited on 2008-01-23, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baculoviral iap repeat-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VM5 (0-1)
    • Uniprot Q13075 (2-105)
    Domains in SCOPe 2.08: d2vm5a1, d2vm5a2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vm5A (A:)
smrvknlksrlrggkmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcf
scggclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk

    Sequence, based on observed residues (ATOM records): (download) 
    >2vm5A (A:)
smrvknlksrlrmryqeeearlasfrnwpfyvqgispcvlseagfvftgkqdtvqcfscg
gclgnweegddpwkehakwfpkceflrskksseeitqyiqsyk