PDB entry 2vlw

View 2vlw on RCSB PDB site
Description: crystal structure of the muscarinic toxin mt7 diiodotyr51 derivative.
Deposited on 2008-01-17, released 2008-10-14
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.2
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscarinic m1-toxin1
    Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: muscarinic m1-toxin1
    Species: DENDROASPIS ANGUSTICEPS, synthetic [TaxId:8618]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2vlwA (A:)
    ltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
    dkcnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >2vlwB (B:)
    ltcvksnsiwfptsedcpdgqnlcfkrwqyisprmydftrgcaatcpkaeyrdvinccgt
    dkcnk