PDB entry 2vlf

View 2vlf on RCSB PDB site
Description: quinonoid intermediate of citrobacter freundii tyrosine phenol-lyase formed with alanine
Class: lyase
Keywords: plp-dependent enzyme, lyase, tyrosine degradation
Deposited on 2008-01-14, released 2008-08-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.158
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vlfa_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vlfb_
  • Heterogens: PLI, PGE, K, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vlfA (A:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vlfB (B:)
    mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmmgdeayagsenfyhlertvqelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayicl
    avtvnlaggqpvsmanmravrelteahgikvfydatrcvenayfikeqeqgfenksiaei
    vhemfsyadgctmsgkkdclvniggflcmnddemfssakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklkaagvpivepvgghavfldarrfcehltqde
    fpaqslaasiyvetgvrsmergiisagrnnvtgehhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirglkfiyepkqlrfftarfdyi