PDB entry 2vl6

View 2vl6 on RCSB PDB site
Description: structural analysis of the sulfolobus solfataricus mcm protein n- terminal domain
Class: DNA binding protein
Keywords: mcm, helicase, hydrolase, zinc-finger, ATP-binding, DNA-binding, ssDNA binding, DNA replication, nucleotide-binding, DNA binding protein
Deposited on 2008-01-08, released 2008-04-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: minichromosome maintenance protein mcm
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vl6a_
  • Chain 'B':
    Compound: minichromosome maintenance protein mcm
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vl6b_
  • Chain 'C':
    Compound: minichromosome maintenance protein mcm
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vl6c_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vl6A (A:)
    meipskqidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenla
    yeiinntkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigkl
    itidgilvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqf
    rlipektklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildik
    qdspvkrgsravfdiymkvssievsqkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vl6A (A:)
    qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn
    tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi
    lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek
    tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk
    rgsravfdiymkvssievs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vl6B (B:)
    meipskqidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenla
    yeiinntkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigkl
    itidgilvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqf
    rlipektklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildik
    qdspvkrgsravfdiymkvssievsqkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vl6B (B:)
    qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn
    tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi
    lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek
    tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk
    rgsravfdiymkvssievs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vl6C (C:)
    meipskqidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenla
    yeiinntkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigkl
    itidgilvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqf
    rlipektklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildik
    qdspvkrgsravfdiymkvssievsqkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vl6C (C:)
    qidyrdvfieflttfkgnnnqnkyierinelvayrkksliiefsdvlsfnenlayeiinn
    tkiilpilegalydhilqldptyqrdiekvhvrivgiprvielrkirstdigklitidgi
    lvkvtpvkeriykatykhihpdcmqefewpedeempevlempticpkcgkpgqfrlipek
    tklidwqkaviqerpeevpsgqlprqleiileddlvdsarpgdrvkvtgildikqdspvk
    rgsravfdiymkvssievs