PDB entry 2vl5

View 2vl5 on RCSB PDB site
Description: structure of anti-collagen type II fab ciic1
Class: immune system
Keywords: rheumatoid factor, immune system, arthritis, autoantibodies, collagen type II
Deposited on 2008-01-08, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ciic1 anticollagen fab
    Species: MUS MUSCULUS [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VL5 (0-217)
    Domains in SCOPe 2.07: d2vl5a1, d2vl5a2
  • Chain 'B':
    Compound: ciic1 anticollagen fab
    Species: MUS MUSCULUS [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d2vl5b1, d2vl5b2
  • Chain 'C':
    Compound: ciic1 anticollagen fab
    Species: MUS MUSCULUS [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2VL5 (0-217)
    Domains in SCOPe 2.07: d2vl5c1, d2vl5c2
  • Chain 'D':
    Compound: ciic1 anticollagen fab
    Species: MUS MUSCULUS [TaxId:10090]
    Gene:
    Domains in SCOPe 2.07: d2vl5d1, d2vl5d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vl5A (A:)
    qvqlqqpgadlvrpgvsvklsckasgytftsywmnwvkqrpgqglewigmihpsdsetrl
    sqkfkdkatltvdkssstaymqlssptsedsavyycarlkpggtwfaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vl5B (B:)
    divltqspasltvslgqratiscrasksvdsygnsfmewyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vl5B (B:)
    divltqspasltvslgqratiscrasksvdsygnsfmewyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vl5C (C:)
    qvqlqqpgadlvrpgvsvklsckasgytftsywmnwvkqrpgqglewigmihpsdsetrl
    sqkfkdkatltvdkssstaymqlssptsedsavyycarlkpggtwfaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vl5D (D:)
    divltqspasltvslgqratiscrasksvdsygnsfmewyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vl5D (D:)
    divltqspasltvslgqratiscrasksvdsygnsfmewyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedpytfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn