PDB entry 2vkv

View 2vkv on RCSB PDB site
Description: tetr (bd) variant l17g with reverse phenotype
Class: transcription
Keywords: transcription, transcription regulation, disorder to order mechanism, antibiotic resistance, helix-turn-helix motif, bacterial repressor, anhydrotetracycline, metal-binding, reverse phenotype, tetr, plasmid, repressor, magnesium, DNA-binding
Deposited on 2008-01-02, released 2008-07-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.18
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04483 (Start-49)
      • engineered mutation (16)
    • Uniprot P0ACT4 (50-End)
    Domains in SCOPe 2.06: d2vkva1, d2vkva2
  • Heterogens: TDC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vkvA (A:)
    msrldkskvinsalelgnevgieglttrklaqklgveqptlywhvknkralldalaveil
    arhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfm
    tengfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsd
    dgeqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vkvA (A:)
    kskvinsalelgnevgieglttrklaqklgveqptlywhvknkralldalaveilarhhd
    yslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengf
    slrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqa
    flhgleslirgfevqltall