PDB entry 2vkr

View 2vkr on RCSB PDB site
Description: 3fe-4s, 4fe-4s plus zn acidianus ambivalens ferredoxin
Class: electron transport
Keywords: zinc, iron, 3fe-4s, 4fe-4s, transport, zn center, hemihedric twinnig, iron-sulfur protein, ferredoxin, methylation, thermophile, iron-sulfur, thermostable protein, metal-binding, protein folding, electron transport
Deposited on 2007-12-23, released 2008-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.2148
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkra_
  • Chain 'B':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkrb_
  • Chain 'C':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkrc_
  • Chain 'D':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkrd_
  • Chain 'E':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkre_
  • Chain 'F':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkrf_
  • Chain 'G':
    Compound: zinc-containing ferredoxin
    Species: ACIDIANUS AMBIVALENS [TaxId:2283]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vkrg_
  • Heterogens: F3S, SF4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrA (A:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrB (B:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrC (C:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrD (D:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrE (E:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrF (F:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkrG (G:)
    gidpnyrtsrqvvgehqghkvygpvdppkvlgihgtivgvdfdlciadgscitacpvnvf
    qwydtpghpasekkadpineqacifcmacvnvcpvaaidvkpp