PDB entry 2vkl

View 2vkl on RCSB PDB site
Description: x-ray crystal structure of the intracellular chorismate mutase from mycobactrerium tuberculosis in complex with malate
Deposited on 2007-12-20, released 2008-01-15
The last revision was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.183
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rv0948c/mt0975
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MLT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2vklA (A:)
    mnlemlesqpvpeidtlreeidrldaeilalvkrraevskaigkarmasggtrlvhsrem
    kvieryselgpdgkdlailllrlgrgrlgh
    

    Sequence, based on observed residues (ATOM records):
    >2vklA (A:)
    eidtlreeidrldaeilalvkrraevskaigkarmasggtrlvhsremkvieryselgpd
    gkdlailllrlgrgrlg