PDB entry 2vkf

View 2vkf on RCSB PDB site
Description: complexes of dodecin with flavin and flavin-like ligands
Class: electron transport
Keywords: biotechnological application of dodecin binding properties, flavin-DNA ligand hybrid, electron transport
Deposited on 2007-12-19, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dodecin
    Species: HALOBACTERIUM SALINARUM [TaxId:478009]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HPW4 (48-61)
      • engineered mutation (43)
    Domains in SCOPe 2.08: d2vkfa1
  • Heterogens: MG, NA, CL, SO4, CF2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkfA (A:)
    vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe
    ld