PDB entry 2vkf

View 2vkf on RCSB PDB site
Description: complexes of dodecin with flavin and flavin-like ligands
Class: electron transport
Keywords: biotechnological application of dodecin binding properties, flavin-DNA ligand hybrid, electron transport
Deposited on 2007-12-19, released 2008-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-06-06, with a file datestamp of 2012-06-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dodecin
  Species: HALOBACTERIUM SALINARUM [TaxId:478009]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HPW4 (48-61)
    • engineered mutation (43)
  Domains in SCOPe 2.08: d2vkfa1
• Heterogens: MG, NA, CL, SO4, CF2, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vkfA (A:)
  vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe
  ld