PDB entry 2vke

View 2vke on RCSB PDB site
Description: Tet repressor class D complexed with cobalt and tetracycline
Class: transcription
Keywords: transcription, metal-binding, helix-turn-helix, transcription regulator, transcription regulation, metal coordination, antibiotic resistance, cobalt, repressor, magnesium, DNA-binding
Deposited on 2007-12-18, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.247
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2vkea1, d2vkea2, d2vkea3
  • Heterogens: TAC, CO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vkeA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vkeA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltenlppllrealqimdsddgeqaflh
    gleslirgfevqltallqiv