PDB entry 2vka

View 2vka on RCSB PDB site
Description: site-directed mutagenesis of the catalytic tryptophan environment in pleurotus eryngii versatile peroxidase
Class: oxidoreductase
Keywords: lignin peroxidase, lignin degradation, manganese peroxidase, polyvalent peroxidase, aromatic-substrate binding, mn-independent oxidation, oxidoreductase
Deposited on 2007-12-18, released 2008-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: versatile peroxidase vpl2
    Species: PLEUROTUS ERYNGII [TaxId:5323]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94753 (0-316)
      • engineered mutation (246)
    Domains in SCOPe 2.08: d2vkaa_
  • Heterogens: SO4, CA, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vkaA (A:)
    atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
    adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
    pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
    ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
    acewqsfvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
    sdveqacaatpfpalta