PDB entry 2vk0

View 2vk0 on RCSB PDB site
Description: crystal structure form ultalente insulin microcrystals
Class: hormone
Keywords: carbohydrate metabolism, glucose metabolism, micro focus beamline, insulin, hormone, secreted, micro crystal, cleavage on pair of basic residues, disease mutation, diabetes mellitus
Deposited on 2007-12-14, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.242
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'B':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (Start-29)
  Domains in SCOPe 2.08: d2vk0b1
• Chain 'C':
  Compound: insulin A chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-20)
• Chain 'D':
  Compound: insulin B chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308
  Domains in SCOPe 2.08: d2vk0d1
• Heterogens: ZN, MPB, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2vk0B (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vk0B (B:)
  nqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2vk0D (D:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vk0D (D:)
  nqhlcgshlvealylvcgergffytpk