PDB entry 2vj0

View 2vj0 on RCSB PDB site
Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
Class: protein transport
Keywords: protein transport, cytoplasmic vesicle, alternative splicing, transport, coated pit, sh3 domain, endocytosis, alpha-adaptin, golgi apparatus, phosphorylation, ap2, synapse, membrane, cytoplasm, coiled coil, amphiphysin, cytoskeleton, synaptojanin, lipid-binding, cell junction
Deposited on 2007-12-06, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ap-2 complex subunit alpha-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VJ0
      • conflict (5)
      • conflict (98)
      • conflict (200-201)
    • Uniprot P17427 (4-249)
    Domains in SCOPe 2.08: d2vj0a1, d2vj0a2
  • Chain 'P':
    Compound: synaptojanin-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: amphiphysin
    Species: RATTUS NORVEGICUS, synthetic [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BEN, DTD, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vj0A (A:)
    gspgilaplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstq
    flnftptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryg
    gtfqnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkak
    iigfgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsq
    rlcellseqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vj0A (A:)
    ilaplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnf
    tptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfq
    nvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigf
    gsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlce
    llseqf
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.