PDB entry 2viu

View 2viu on RCSB PDB site
Description: influenza virus hemagglutinin
Class: hemagglutinin
Keywords: hemagglutinin, envelope protein, glycoprotein
Deposited on 1997-12-22, released 1998-04-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (Start-327)
      • engineered (130)
    Domains in SCOPe 2.05: d2viua_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2viub_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2viuA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgviqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2viuA (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gviqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekqt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2viuB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg