PDB entry 2vis

View 2vis on RCSB PDB site
Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody
Class: complex (hemagglutinin/immunoglobulin)
Keywords: COMPLEX (HEMAGGLUTININ-IMMUNOGLOBULIN), GLYCOPROTEIN, COMPLEX (HEMAGGLUTININ-IMMUNOGLOBULIN) complex
Deposited on 1997-12-22, released 1998-04-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.188
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin (igg1, lambda)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-209)
    Domains in SCOPe 2.01: d2visa1, d2visa2
  • Chain 'B':
    Compound: immunoglobulin (igg1, lambda)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAD00000 (0-220)
      • conflict (2)
      • conflict (4)
      • conflict (27)
      • conflict (29)
      • conflict (31)
      • conflict (62)
      • conflict (68)
      • conflict (82)
      • conflict (91)
      • insertion (97-99)
      • conflict (101-102)
      • insertion (104-109)
      • conflict (116)
      • conflict (121)
      • conflict (134)
    Domains in SCOPe 2.01: d2visb1, d2visb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (Start-281)
      • engineered (103)
    Domains in SCOPe 2.01: d2visc_
  • Heterogens: NAG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visA (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visB (B:)
    qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
    salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2visC (C:)
    titddqievtnatelvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlf
    verskafsncypydvpdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgf
    fsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstr
    rsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssi
    mrsdapidtcisecitpngsipndkpfqnvnkitygacpkyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2visC (C:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgffsrlnwltksgstyp
    vlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpngsipndkpfqnvnkitygacpkyv