PDB entry 2vis

View 2vis on RCSB PDB site
Description:
Deposited on 1997-12-22, released 1998-04-29
The last revision prior to the SCOP 1.65 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.188
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2visa1, d2visa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2visb1, d2visb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d2visc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visA (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2visB (B:)
    qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
    salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2visC (C:)
    titddqievtnatelvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlf
    verskafsncypydvpdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgf
    fsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstr
    rsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssi
    mrsdapidtcisecitpngsipndkpfqnvnkitygacpkyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2visC (C:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgviqnggsnackrgpgsgffsrlnwltksgstyp
    vlnvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpngsipndkpfqnvnkitygacpkyv