PDB entry 2vim

View 2vim on RCSB PDB site
Description: X-ray structure of Fasciola hepatica thioredoxin
Class: oxidoreductase
Keywords: thioredoxin, trx, thioredoxin fold, oxidoreductase
Deposited on 2007-12-05, released 2008-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Fasciola hepatica [TaxId:6192]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U1G7 (0-103)
  Domains in SCOPe 2.08: d2vima_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vimA (A:)
  mrvlataadleklinenkgrlivvdffaqwcgpcrniapkvealakeipevefakvdvdq
  neeaaakysvtamptfvfikdgkevdrfsganetklretitrhk