PDB entry 2vik

View 2vik on RCSB PDB site
Description: refined structure of the actin-severing domain villin 14t, determined by solution nmr, minimized average structure
Deposited on 1997-01-16, released 1997-04-01
The last revision prior to the SCOP 1.61 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2vik__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vik_ (-)
    velskkvtgkldkttpgiqiwrienmemvpvptksygnfyegdcyvllstrktgsgfsyn
    ihywlgknssqdeqgaaaiyttqmdeylgsvavqhrevqghesetfrayfkqgliykqgg
    vasgmk