PDB entry 2vig

View 2vig on RCSB PDB site
Description: crystal structure of human short-chain acyl coa dehydrogenase
Class: oxidoreductase
Keywords: fatty acid metabolism, fad, polymorphism, flavoprotein, mitochondrion, disease mutation, lipid metabolism, oxidoreductase, beta oxidation, transit peptide
Deposited on 2007-11-30, released 2007-12-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2viga1, d2viga2
  • Chain 'B':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG
      • conflict see remark 9 (180)
    • Uniprot P16219
    Domains in SCOPe 2.03: d2vigb1, d2vigb2
  • Chain 'C':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG (384-End)
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2vigc1, d2vigc2
  • Chain 'D':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG (384-End)
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2vigd1, d2vigd2
  • Chain 'E':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG (384-End)
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2vige1, d2vige2
  • Chain 'F':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG (384-End)
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2vigf1, d2vigf2
  • Chain 'G':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG
      • conflict see remark 9 (180)
    • Uniprot P16219
    Domains in SCOPe 2.03: d2vigg1, d2vigg2
  • Chain 'H':
    Compound: short-chain specific acyl-coa dehydrogenase,
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VIG (384-End)
      • conflict see remark 9 (180)
    • Uniprot P16219 (Start-383)
    Domains in SCOPe 2.03: d2vigh1, d2vigh2
  • Heterogens: FAD, EDO, COS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vigA (A:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigA (A:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
    lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgri
    giasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraam
    lkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyeg
    tseiqrlviaghllrsyrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vigB (B:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigB (B:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastsisaflvpmptp
    gltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigiasqal
    giaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkdnkkp
    fikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtseiqrl
    viaghllrsyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vigC (C:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigC (C:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdsisaflvpmpt
    pgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigiasqa
    lgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkdnkk
    pfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtseiqr
    lviaghllrsyrsaenlyf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vigD (D:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigD (D:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdksisaflvpmp
    tpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigiasq
    algiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkdnk
    kpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtseiq
    rlviaghllrsyrsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vigE (E:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigE (E:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnksisaf
    lvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgri
    giasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraam
    lkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyeg
    tseiqrlviaghllrsyrsa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vigF (F:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigF (F:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdsisaflvpmpt
    pgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigiasqa
    lgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkdnkk
    pfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtseiqr
    lviaghllrsyrsa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vigG (G:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigG (G:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdqnksisaflvp
    mptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigia
    sqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkd
    nkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtse
    iqrlviaghllrsyr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vigH (H:)
    mqsvelpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeel
    ggagldylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdk
    igcfalsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastdralqnk
    sisaflvpmptpgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtl
    dmgrigiasqalgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarllt
    wraamlkdnkkpfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdarit
    eiyegtseiqrlviaghllrsyrsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vigH (H:)
    lpethqmllqtcrdfaekelfpiaaqvdkehlfpaaqvkkmgglgllamdvpeelggagl
    dylayaiameeisrgcastgvimsvnnslylgpilkfgskeqkqawvtpftsgdkigcfa
    lsepgngsdagaasttaraegdswvlngtkawitnaweasaavvfastksisaflvpmpt
    pgltlgkkedklgirgsstanlifedcripkdsilgepgmgfkiamqtldmgrigiasqa
    lgiaqtaldcavnyaenrmafgapltklqviqfkladmalalesarlltwraamlkdnkk
    pfikeaamaklaaseaataishqaiqilggmgyvtempaerhyrdariteiyegtseiqr
    lviaghllrsyrsa