PDB entry 2vhu

View 2vhu on RCSB PDB site
Description: p4 protein from bacteriophage phi12 k241c mutant in complex with ADP and mgcl
Class: hydrolase
Keywords: virus dsRNA, hydrolase, molecular motor, packaging ATPase, hexameric helicase, non-hydrolysable ATP analogue
Deposited on 2007-11-25, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d2vhua_
  • Chain 'B':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d2vhub_
  • Chain 'C':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (240)
    Domains in SCOPe 2.07: d2vhuc_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vhuA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    civelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhuA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddcivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vhuB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    civelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhuB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddcivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vhuC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    civelvkeasrsnstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhuC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddcivelvkeasr
    snstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk