PDB entry 2vhj

View 2vhj on RCSB PDB site
Description: p4 protein from bacteriophage phi12 s252a mutant in complex with ADP
Class: hydrolase
Keywords: non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase
Deposited on 2007-11-21, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (251)
    Domains in SCOPe 2.07: d2vhja_
  • Chain 'B':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (251)
    Domains in SCOPe 2.07: d2vhjb_
  • Chain 'C':
    Compound: ntpase p4
    Species: PSEUDOMONAS PHAGE PHI12 [TaxId:161736]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94M05 (0-End)
      • engineered mutation (251)
    Domains in SCOPe 2.07: d2vhjc_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vhjA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasranstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhjA (A:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    anstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vhjB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasranstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhjB (B:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    anstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vhjC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknvigaaggnttsggisrgafdllsdigamaasrgcvviaslnptsndd
    kivelvkeasranstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk
    qsggkqasgkaiqtvikndelesvlrrltsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vhjC (C:)
    mihlydaksfaklraaqyaafhtdapgswfdhtsgvlesvedgtpvlaigvesgdaivfd
    knaqrivaykeksvkaedgsvsvvqvengfmkqghrgwlvdltgelvgcspvvaefgghr
    yasgmvivtgkgnsgktplvhalgealggkdkyatvrfgeplsgyntdfnvfvddiaram
    lqhrvividslknviisrgafdllsdigamaasrgcvviaslnptsnddkivelvkeasr
    anstslvistdvdgewqvltrtgeglqrlthtlqtsygehsvltihtsk