PDB entry 2vhd

View 2vhd on RCSB PDB site
Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa- mixed valence form
Class: oxidoreductase
Keywords: iron, heme, periplasm, transport, peroxidase, metal-binding, oxidoreductase, electron transport
Deposited on 2007-11-20, released 2008-02-12
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-26, with a file datestamp of 2008-02-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18695
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c551 peroxidase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vhda1, d2vhda2
  • Chain 'B':
    Compound: cytochrome c551 peroxidase
    Species: PSEUDOMONAS AERUGINOSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vhdb1, d2vhdb2
  • Heterogens: CA, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhdA (A:)
    dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
    gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
    lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlvtpdspfdlylkgddka
    ldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasvlpsgdkgrfavtktqs
    deyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddvenivaflhsls
    gkqprveypllpastettprpae
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vhdB (B:)
    dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
    gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
    lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlvtpdspfdlylkgddka
    ldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasvlpsgdkgrfavtktqs
    deyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkqlapddvenivaflhsls
    gkqprveypllpastettprpae