PDB entry 2vh9

View 2vh9 on RCSB PDB site
Description: crystal structure of nxg1-deltayniig in complex with xllg, a xyloglucan derived oligosaccharide
Class: hydrolase
Keywords: hydrolase, glycosidase, family gh16, tropaeolum majus xyloglucanase, xllg oligosaccharide, loop mutant nxg1-yniig, substrate complex, glycoside hydrolase
Deposited on 2007-11-20, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.151
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vh9a_
  • Chain 'B':
    Compound: cellulase
    Species: TROPAEOLUM MAJUS [TaxId:4020]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2vh9b_
  • Heterogens: ZN, GOL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vh9A (A:)
    mppnilsiflhllpilmfsssclgqgppspgyypssqitslgfdqgytnlwgpqhqrvdq
    gsltiwldstsgsgfksinryrsgyfganiklqsgytagvitsfylsnnqdypgkhdeid
    ieflgtipgkpytlqtnvfiegsgdremrihlwfdptqdyhnyaiywtpseiiffvddvp
    irryprksdatfplrplwvygsvwdasswatengkykadyryqpfvgkyedfklgsctve
    aasscnpasvspygqlsqqqvaamewvqknymvynycddptrdhtltpec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vh9A (A:)
    qgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsg
    yfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsg
    dremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsvw
    dasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaam
    ewvqknymvynycddptrdhtltpec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vh9B (B:)
    mppnilsiflhllpilmfsssclgqgppspgyypssqitslgfdqgytnlwgpqhqrvdq
    gsltiwldstsgsgfksinryrsgyfganiklqsgytagvitsfylsnnqdypgkhdeid
    ieflgtipgkpytlqtnvfiegsgdremrihlwfdptqdyhnyaiywtpseiiffvddvp
    irryprksdatfplrplwvygsvwdasswatengkykadyryqpfvgkyedfklgsctve
    aasscnpasvspygqlsqqqvaamewvqknymvynycddptrdhtltpec
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vh9B (B:)
    qgppspgyypssqitslgfdqgytnlwgpqhqrvdqgsltiwldstsgsgfksinryrsg
    yfganiklqsgytagvitsfylsnnqdypgkhdeidieflgtipgkpytlqtnvfiegsg
    dremrihlwfdptqdyhnyaiywtpseiiffvddvpirryprksdatfplrplwvygsvw
    dasswatengkykadyryqpfvgkyedfklgsctveaasscnpasvspygqlsqqqvaam
    ewvqknymvynycddptrdhtltpec