PDB entry 2vh7

View 2vh7 on RCSB PDB site
Description: Crystal structure of human common-type acylphosphatase
Class: hydrolase
Keywords: hydrolase
Deposited on 2007-11-19, released 2009-03-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.209
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vh7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vh7A (A:)
    maegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvr
    hmqewletrgspkshidkanfnnekvilkldysdfqivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vh7A (A:)
    tlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvrhmqew
    letrgspkshidkanfnnekvilkldysdfqivk