PDB entry 2vgx

View 2vgx on RCSB PDB site
Description: structure of the yersinia enterocolitica type III secretion translocator chaperone sycd
Class: chaperone
Keywords: alternative dimer assembly, chaperone, sycd, tetratricopeptide repeat, type III secretion
Deposited on 2007-11-16, released 2007-12-04
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-15, with a file datestamp of 2008-01-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.17753
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone sycd
    Species: Yersinia enterocolitica
    Database cross-references and differences (RAF-indexed):
    • PDB 2VGX
    • Uniprot O87496 (5-End)
    Domains in SCOP 1.75: d2vgxa1
  • Chain 'B':
    Compound: chaperone sycd
    Species: Yersinia enterocolitica
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgxA (A:)
    gplgsgggtiamlneissdtleqlyslafnqyqsgkyedahkvfqalcvldhydsrfflg
    lgacrqamgqydlaihsysygavmdikeprfpfhaaecllqkgelaeaesglflaqelia
    nkpefkelstrvssmleaiklkkemkhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgxA (A:)
    gggtiamlneissdtleqlyslafnqyqsgkyedahkvfqalcvldhydsrfflglgacr
    qamgqydlaihsysygavmdikeprfpfhaaecllqkgelaeaesglflaqeliankpef
    kelstrvssmleai
    

  • Chain 'B':
    No sequence available.