PDB entry 2vgm

View 2vgm on RCSB PDB site
Description: structure of yeast dom34 : a protein related to translation termination factor erf1 and involved in no-go decay.
Class: cell cycle
Keywords: translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation, nucleotide binding, mitosis, meiosis, cytoplasm, cell cycle, no-go decay
Deposited on 2007-11-14, released 2008-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-22, with a file datestamp of 2008-01-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dom34
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vgma1, d2vgma2, d2vgma3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgmA (A:)
    mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkftskldeagkkkst
    dlvklkikvisedfdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikq
    nfnkfmqkllneacnieyksdtaavvlqegiahvclvtssstilkqkieysmpkkkrttd
    vlkfdektekfykaiysamkkdlnfdklktiilcspgfyakilmdkifqyaeeehnkkil
    dnkgmffiahcstgylqginevlknplyasklqdtkyskeimvmdefllhlnkdddkawy
    gekevvkaaeygaisyllltdkvlhsdniaqreeylklmdsvesnggkalvlstlhslge
    eldqltgiacilkyplpdldeddgee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgmA (A:)
    mkvislkggavitllpedkedlftvyqivdkddelifkkkftdlvklkikvisedfdmkd
    eylkykgvtvtdesgasnvdipvgkylsftldyvypftiikqnfnkfmqkllneacniey
    ksdtaavvlqegiahvclvtssstilkqkietdvlkfdektekfykaiysamkkdlnfdk
    lktiilcspgfyakilmdkifqyaeeehnkkildnkgmffiahcstgylqginevlknpl
    yasklqdtkyskeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlhsd
    niaqreeylklmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde