PDB entry 2vgl

View 2vgl on RCSB PDB site
Description: ap2 clathrin adaptor core
Class: protein transport
Keywords: cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport, coated pit, phosphorylation, protein transport
Deposited on 2007-11-14, released 2007-12-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.265
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adaptor protein complex ap-2, alpha 2 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vgla_
  • Chain 'B':
    Compound: AP-2 complex subunit beta-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vglb_
  • Chain 'M':
    Compound: ap-2 complex subunit mu-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vglm1
  • Chain 'S':
    Compound: ap-2 complex subunit sigma-1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vgls_
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vglA (A:)
    mpavskgegmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvc
    kllfifllghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndl
    asrnptfmglalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtsp
    dlvpmgdwtsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsa
    stdlqdytyyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkv
    qhsnaknavlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlasse
    fsheavkthietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysi
    reeivlkvailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaa
    ktvfealqapachenlvkvggyilgefgnliagdprsspliqfnllhskfhlcsvptral
    llstyikfvnlfpevkatiqdvlrsdsqlknadvelqqraveylrlstvastdilatvle
    emppfperessilaklkkkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vglA (A:)
    gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
    ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
    glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
    tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
    yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
    vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
    hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
    ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
    apachenlvkvggyilgefgnliagdprsspliqfnllhskfhlcsvptralllstyikf
    vnlfpevkatiqdvlrsdsqlknadvelqqraveylrlstvastdilatvleemppfper
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vglB (B:)
    mtdskyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvana
    vaalseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsi
    cervtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqy
    valrninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrk
    ypnkyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqv
    qltlltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakev
    vlsekpliseetdlieptlldelichigslasvyhkppnafvegshgihrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vglB (B:)
    skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
    elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
    eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
    lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
    vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
    rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
    evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
    kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
    lltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvls
    ekpliseetdlieptlldelichigslasvyhkppnafv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vglM (M:)
    migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
    sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
    pqnsetgalktfitqqgiksqhqtkeeqsqitsqvtgqigwrregikyrrnelfldvles
    vnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndkiviekqgkgtadetsksgkqs
    iaiddctfhqcvrlskfdsersisfippdgefelmryrttkdiilpfrviplvrevgrtk
    levkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrmag
    mkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvik
    wvryigrsgiyetrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vglM (M:)
    migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr
    sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy
    pqnsetgalktfitqqgiksqigwrregikyrrnelfldvlesvnllmspqgqvlsahvs
    grvvmksylsgmpeckfgmndkivisiaiddctfhqcvrlsrsisfippdgefelmryrt
    tkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicmk
    gkakykasenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsgl
    kvrylkvfepklnysdhdvikwvryigrsgiyetrc
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vglS (S:)
    mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
    ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
    geiretsqtkvlkqllmlqsle