PDB entry 2vgl

View 2vgl on RCSB PDB site
Description: ap2 clathrin adaptor core
Class: protein transport
Keywords: cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport, coated pit, phosphorylation, protein transport
Deposited on 2007-11-14, released 2007-12-25
The last revision prior to the SCOP 1.75 freeze date was dated 2007-12-25, with a file datestamp of 2007-12-21.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.26483
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adaptor protein complex ap-2, alpha 2 subunit
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: AP-2 complex subunit beta-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vglb1
  • Chain 'M':
    Compound: ap-2 complex subunit mu-1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ap-2 complex subunit sigma-1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2vgls1
  • Heterogens: IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vglB (B:)
    mtdskyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvana
    vaalseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsi
    cervtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqy
    valrninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrk
    ypnkyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqv
    qltlltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakev
    vlsekpliseetdlieptlldelichigslasvyhkppnafvegshgihrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vglB (B:)
    skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
    elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
    eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
    lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
    vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
    rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
    evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
    kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
    lltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvls
    ekpliseetdlieptlldelichigslasvyhkppnafv
    

  • Chain 'M':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vglS (S:)
    mirfiliqnragktrlakwymqfdddekqklieevhavvtvrdakhtnfvefrnfkiiyr
    ryaglyfcicvdvndnnlayleaihnfvevlneyfhnvceldlvfnfykvytvvdemfla
    geiretsqtkvlkqllmlqsle