PDB entry 2vgi

View 2vgi on RCSB PDB site
Description: human erythrocyte pyruvate kinase: r486w mutant
Class: transferase
Keywords: glycolysis, transferase
Deposited on 2007-11-13, released 2007-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.258
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (439)
    Domains in SCOPe 2.05: d2vgia1, d2vgia2, d2vgia3
  • Chain 'B':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (439)
    Domains in SCOPe 2.05: d2vgib1, d2vgib2, d2vgib3
  • Chain 'C':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (439)
    Domains in SCOPe 2.05: d2vgic1, d2vgic2, d2vgic3
  • Chain 'D':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (439)
    Domains in SCOPe 2.05: d2vgid1, d2vgid2, d2vgid3
  • Heterogens: FBP, PGA, K, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgiA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgiA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgiB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgiB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivlvtantvdy
    pniviyiddglislvvvtvenggvkgvnlplpglseqdvrdlrfgvehgvdivfasfvrk
    asdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvf
    laqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetak
    gnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaa
    iivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvd
    rrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vgiC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgiC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgadlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavr
    aalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmig
    rcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveav
    kmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttg
    rsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgie
    sgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vgiD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgiD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilesevelvkg
    sqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqv
    enggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraa
    lgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrc
    nlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkm
    qhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrs
    aqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesg
    klrgflrvgdlvivvtgwrpgsgytnimrvlsi