PDB entry 2vgg

View 2vgg on RCSB PDB site
Description: human erythrocyte pyruvate kinase: r479h mutant
Class: transferase
Keywords: metal-binding, phosphorylation, pyruvate kinase in the active r-state, kinase, pyruvate, magnesium, glycolysis, transferase, disease mutation
Deposited on 2007-11-13, released 2007-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.254
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (432)
    Domains in SCOPe 2.05: d2vgga1, d2vgga2, d2vgga3
  • Chain 'B':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (432)
    Domains in SCOPe 2.05: d2vggb1, d2vggb2, d2vggb3
  • Chain 'C':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (432)
    Domains in SCOPe 2.05: d2vggc1, d2vggc2, d2vggc3
  • Chain 'D':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (432)
    Domains in SCOPe 2.05: d2vggd1, d2vggd2, d2vggd3
  • Heterogens: FBP, PGA, K, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vggA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttghsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vggA (A:)
    amadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarlnfshgs
    heyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpesevelvkgsqv
    lvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqeglvtqvenggvlg
    srkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghg
    ikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpv
    vcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkmqhaiare
    aeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsry
    rpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflr
    vgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vggB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttghsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vggB (B:)
    qqqqlpadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarlnf
    shgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtivelvkgsqvlvtan
    tvwvdypnivrvvpvggriyiddglislvvvenggvlgsrkgvnlpgaqdlpglseqdvr
    dlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevs
    dgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsd
    vanavldgadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrd
    ptevtaigaveaafkccaaaiivltttghsaqllsryrpraaviavtrsaqaarqvhlcr
    gvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrv
    lsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vggC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttghsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vggC (C:)
    qqqlpaadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarlnf
    shgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpesevelvk
    gsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtq
    venggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavra
    algpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigr
    cnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavk
    mqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgh
    saqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgies
    gklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vggD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttghsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vggD (D:)
    paatflehlcllidsepvaarstsiiatigpasrsverlkemikagmniarlnfshgshe
    yhaesianvreavesfagsplsyrpvaialdtkgpeirtgilesevelvkgsqlvtvdpa
    frtrgnantvwvdypnivrvvpvggriyiddglislvvqkipelvtqvenggvlgsrkgv
    nlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiis
    kienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatq
    mlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkmqhaiareaeaav
    yhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttghsaqllsryrpraa
    viavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlv
    ivvtgwrpgsgytnimrvlsi