PDB entry 2vgf

View 2vgf on RCSB PDB site
Description: human erythrocyte pyruvate kinase: t384m mutant
Class: transferase
Keywords: metal-binding, phosphorylation, r-state, glycolysis, transferase
Deposited on 2007-11-12, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.269
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (337)
    Domains in SCOPe 2.07: d2vgfa1, d2vgfa2, d2vgfa3
  • Chain 'B':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (337)
    Domains in SCOPe 2.07: d2vgfb1, d2vgfb2, d2vgfb3
  • Chain 'C':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (337)
    Domains in SCOPe 2.07: d2vgfc1, d2vgfc2, d2vgfc3
  • Chain 'D':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered mutation (337)
    Domains in SCOPe 2.07: d2vgfd1, d2vgfd2, d2vgfd3
  • Heterogens: FBP, PGA, K, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgfA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgfA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgfB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgfB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivelvkgsqvl
    vtantvwvdypnivrvvpvggriyiddglislvvvtqvenggvlgsrkgvnlpgaqvdlp
    glseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkr
    fdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkpr
    pmraetsdvanavldgadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfeelr
    raaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrsaqa
    arqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgs
    gytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vgfC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgfC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vgfD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgfD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgpesevelvkgs
    qvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqve
    nggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraal
    gpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrcn
    lagkpvvcatqmlesmitkprpmraetsdvanavldgadcimlsgetakgnfpveavkmq
    haiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrsa
    qllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgk
    lrgflrvgdlvivvtgwrpgsgytnimrvlsi