PDB entry 2vgd

View 2vgd on RCSB PDB site
Description: crystal structure of environmental isolated gh11 in complex with xylobiose and feruloyl-arabino-xylotriose
Class: hydrolase
Keywords: glycoside hydrolase, xylanase, beta jelly roll, hydrolase
Deposited on 2007-11-12, released 2007-12-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enxyn11a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VGD
    Domains in SCOPe 2.07: d2vgda_
  • Heterogens: NA, FX3, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgdA (A:)
    mislkrvaallcvaglgmsaanaqtcltssqtgtnngfyysfwkdspgtvnfclqsggry
    tsnwsginnwvggkgwqtgsrrnitysgsfnspgngylalygwttnplveyyvvdswgsw
    rppgsdgtflgtvnsdggtydiyraqrvnapsiignatfyqywsvrqskrvggtittgnh
    fdawasvglnlgthnyqimategyqssgssditvsegg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgdA (A:)
    aqtcltssqtgtnngfyysfwkdspgtvnfclqsggrytsnwsginnwvggkgwqtgsrr
    nitysgsfnspgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydi
    yraqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimate
    gyqssgssditvseg