PDB entry 2vgb

View 2vgb on RCSB PDB site
Description: human erythrocyte pyruvate kinase
Class: transferase
Keywords: metal-binding, phosphorylation, pyruvate kinase in the active r-state, kinase, pyruvate, magnesium, glycolysis, transferase, disease mutation
Deposited on 2007-11-12, released 2007-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.229
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgba1, d2vgba2, d2vgba3
  • Chain 'B':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgbb1, d2vgbb2, d2vgbb3
  • Chain 'C':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgbc1, d2vgbc2, d2vgbc3
  • Chain 'D':
    Compound: pyruvate kinase isozymes r/l
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vgbd1, d2vgbd2, d2vgbd3
  • Heterogens: FBP, PGA, K, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vgbA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgbA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vgbB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgbB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivelvkgsqvl
    vtantvwvdypnivrvvpvggriyiddglislvvvtqvenggvlgsrkgvnlpgaqvdlp
    glseqdvrdlrfgvehgvdivfasfvrkasdvaavraalgpeghgikiiskienhegvkr
    fdeilevsdgimvargdlgieipaekvflaqkmmigrcnlagkpvvcatqmlesmitkpr
    ptraetsdvanavldgadcimlsgetakgnfpveavkmqhaiareaeaavyhrqlfeelr
    raaplsrdptevtaigaveaafkccaaaiivltttgrsaqllsryrpraaviavtrsaqa
    arqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgs
    gytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vgbC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgbC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vgbD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vgbD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgiesevelvkgs
    qvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqve
    nggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraal
    gpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrcn
    lagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkmq
    haiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrsa
    qllsryrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgk
    lrgflrvgdlvivvtgwrpgsgytnimrvlsi