PDB entry 2vg9

View 2vg9 on RCSB PDB site
Description: Crystal structure of Loop Swap mutant of Necallimastix patriciarum Xyn11A
Class: hydrolase
Keywords: xylanase, hydrolase, glycosidase, beta jelly roll, multifunctional enzyme, xylan degradation, glycoside hydrolase
Deposited on 2007-11-09, released 2007-12-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional endo-1,4-beta-xylanase a
    Species: NEOCALLIMASTIX PATRICIARUM [TaxId:4758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VG9 (24-28)
    • Uniprot P29127 (29-216)
    Domains in SCOPe 2.06: d2vg9a_
  • Heterogens: CD, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vg9A (A:)
    mkftvgngqnqhkgvndgfsyeiwtnggegsmtlgsgatfkaewnaavnrgnflarrgld
    fgsqkkatdydyigldyaatykqtasasgnsrlcvygwfqnrglngvplveyyiiedwvd
    wvpdaqgkmvtidgaqykifqmdhtgptinggsetfkqyfsvrqqkrtsghitvsdhfke
    wakqgwgignlyevalnaegwqssgvadvtlldvytt