PDB entry 2vfg

View 2vfg on RCSB PDB site
Description: crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase with 3-phosphoglycerate bound at the dimer interface
Class: isomerase
Keywords: plasmodium falciparum, fatty acid biosynthesis, triosephosphate isomerase, pentose shunt, gluconeogenesis, lipid synthesis, tim, mutant, loop open, isomerase, glycolysis
Deposited on 2007-11-04, released 2008-12-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.21028
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2vfga_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2vfgb_
  • Chain 'C':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2vfgc_
  • Chain 'D':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.05: d2vfgd_
  • Heterogens: 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vfgA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfgA (A:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vfgB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfgB (B:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vfgC (C:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfgC (C:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vfgD (D:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfgD (D:)
    rkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfstg
    iqnvskfgngsytgevsaeiakdlnieyviighherrkyfhetdedvreklqaslknnlk
    avvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqaq
    lvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvd
    iiksam