PDB entry 2vfd

View 2vfd on RCSB PDB site
Description: crystal structure of the f96s mutant of plasmodium falciparum triosephosphate isomerase
Class: isomerase
Keywords: plasmodium falciparum, fatty acid biosynthesis, triosephosphate isomerase, pentose shunt, gluconeogenesis, lipid synthesis, tim, mutant, loop open, isomerase, glycolysis
Deposited on 2007-11-03, released 2008-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16628
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.06: d2vfda_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07412 (Start-247)
      • engineered mutation (95)
      • engineered mutation (162)
    Domains in SCOPe 2.06: d2vfdb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vfdA (A:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfdA (A:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vfdB (B:)
    markyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfs
    tgiqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknn
    lkavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeq
    aqlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesf
    vdiiksam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vfdB (B:)
    arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
    giqnvskfgngsytgevsaeiakdlnieyviighserrkyfhetdedvreklqaslknnl
    kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
    qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
    diiksam