PDB entry 2vet

View 2vet on RCSB PDB site
Description: crystal structure of the thymidylate synthase k48q complexed with dump
Class: transferase
Keywords: repressor, cytoplasm, RNA-binding, transferase, nucleotide biosynthesis, dump substrate, methyltransferase, thymidylate synthase, translation regulation
Deposited on 2007-10-26, released 2007-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thymidylate synthase
  Species: ESCHERICHIA COLI [TaxId:511693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A884 (0-263)
    • engineered mutation (47)
  Domains in SCOPe 2.08: d2veta_
• Heterogens: FMT, UMP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vetA (A:)
  mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttqrchlrsiihell
  wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
  ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
  yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
  dyrfedfeiegydphpgikapvai