PDB entry 2ver

View 2ver on RCSB PDB site
Description: structural model for the complex between the dr adhesins and carcinoembryonic antigen (cea)
Class: cell adhesion
Keywords: membrane, fimbrium, gpi-anchor, lipoprotein, immunoglobulin domain, cell adhesion, cell projection
Deposited on 2007-10-26, released 2008-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afimbrial adhesin afa-III
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57254 (0-122)
      • expression tag (123-142)
    Domains in SCOPe 2.08: d2vera1, d2vera2
  • Chain 'N':
    Compound: arcinoembryonic antigen-related cell adhesion molecule 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06731 (0-109)
      • conflict (38)
      • conflict (42)
      • conflict (53)
  • Heterogens: MTN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2verA (A:)
    eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
    nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
    wakdnkqgftpsgttgttkltvt
    

  • Chain 'N':
    No sequence available.