PDB entry 2vem

View 2vem on RCSB PDB site
Description: structure-based enzyme engineering efforts with an inactive monomeric tim variant: the importance of a single point mutation for generating an active site with suitable binding properties
Class: isomerase
Keywords: isomerase, triosephosphate isomerase, tim barrel, glycolysis, engineering, pentose shunt, binding pocket, gluconeogenesis, lipid synthesis, substrate specificity, fatty acid biosynthesis, tim, enzyme, monomeric, glycosome
Deposited on 2007-10-25, released 2008-02-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosomal triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (223)
      • conflict (12)
      • conflict (65-69)
      • conflict (71-72)
      • conflict (90)
    Domains in SCOPe 2.01: d2vema_
  • Chain 'B':
    Compound: glycosomal triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • engineered mutation (223)
      • conflict (12)
      • conflict (15-16)
      • conflict (65-69)
      • conflict (71-72)
      • conflict (90)
    Domains in SCOPe 2.01: d2vemb_
  • Heterogens: BBR, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vemA (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vemA (A:)
    skpqpiaaanwksslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfviaaqn
    agnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacigetlqe
    resgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahalirsw
    vsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vemB (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflaglkpefvdiikatq