PDB entry 2vei

View 2vei on RCSB PDB site
Description: Structure-based enzyme engineering efforts with an inactive monomeric TIM variant: the importance of a single point mutation for generating an active site with suitable binding properties
Class: isomerase
Keywords: isomerase, triosephosphate isomerase, tim barrel, glycolysis, engineering, pentose shunt, binding pocket, gluconeogenesis, lipid synthesis, substrate specificity, fatty acid biosynthesis, tim, enzyme, monomeric, glycosome
Deposited on 2007-10-24, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosomal triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • conflict (12)
      • conflict (15-16)
      • conflict (65-69)
      • conflict (71-72)
      • conflict (90)
    Domains in SCOPe 2.07: d2veia_
  • Chain 'B':
    Compound: glycosomal triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • conflict (12)
      • conflict (15-16)
      • conflict (65-69)
      • conflict (71-72)
      • conflict (90)
    Domains in SCOPe 2.07: d2veib_
  • Chain 'C':
    Compound: glycosomal triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (225-237)
      • conflict (12)
      • conflict (15-16)
      • conflict (65-69)
      • conflict (71-72)
      • conflict (90)
    Domains in SCOPe 2.07: d2veic_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2veiA (A:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2veiB (B:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2veiC (C:)
    skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
    aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
    tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeahal
    irswvsskigadvagelrilyggsvngknartlyqqrdvngflvglkpefvdiikatq