PDB entry 2ve9

View 2ve9 on RCSB PDB site
Description: xray structure of kops bound gamma domain of ftsk (p. aeruginosa)
Class: transport protein
Keywords: nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, translocase, winged helix, bacterial cell division, transport protein, cell division, transmembrane, inner membrane, ftsz, ftsk, membrane, cell cycle, DNA binding
Deposited on 2007-10-17, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9a_
  • Chain 'B':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9b_
  • Chain 'C':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9c_
  • Chain 'D':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9d_
  • Chain 'E':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9e_
  • Chain 'F':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve9f_
  • Chain 'I':
    Compound: 5'-d(*ap*cp*cp*ap*gp*gp*gp*cp*ap*gp *gp*gp*cp*gp*ap*c)-3'
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
  • Chain 'J':
    Compound: 5'-d(*gp*tp*cp*gp*cp*cp*cp*tp*gp*cp *cp*cp*tp*gp*gp*t)-3'
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
  • Chain 'K':
    Compound: 5'-d(*ap*cp*cp*ap*gp*gp*gp*cp*ap*gp *gp*gp*cp*gp*ap*c)-3'
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
  • Chain 'L':
    Compound: 5'-d(*gp*tp*cp*gp*cp*cp*cp*tp*gp*cp *cp*cp*tp*gp*gp*t)-3'
    Species: PSEUDOMONAS AERUGINOSA, synthetic [TaxId:287]
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ve9A (A:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9A (A:)
    ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevia
    pap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ve9B (B:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9B (B:)
    dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
    ap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ve9C (C:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9C (C:)
    ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevia
    pap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ve9D (D:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9D (D:)
    dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
    apv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ve9E (E:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9E (E:)
    dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
    apv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ve9F (F:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve9F (F:)
    eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
    apap
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.