PDB entry 2ve4

View 2ve4 on RCSB PDB site
Description: substrate free cyanobacterial cyp120a1
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, metal-binding, heme, iron
Deposited on 2007-10-16, released 2008-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.234
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome p450 120
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ve4a_
  • Chain 'B':
    Compound: putative cytochrome p450 120
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2ve4b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ve4A (A:)
    mitsptnlnslpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifis
    galanrflftkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsy
    lpkmdgivqgyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqg
    lfslpiplpntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqpls
    lpelkdqillllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkk
    mpyldqvlqevlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpe
    kfdperftpdgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgq
    nlelvvtpsprpkdnlrvklhslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve4A (A:)
    lpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflft
    keqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivqg
    yleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplpn
    tlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqill
    llfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlqe
    vlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpd
    gsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsp
    rpkdnlrvklh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ve4B (B:)
    mitsptnlnslpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifis
    galanrflftkeqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsy
    lpkmdgivqgyleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqg
    lfslpiplpntlfgksqraralllaelekiikarqqqppseedalgillaarddnnqpls
    lpelkdqillllfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkk
    mpyldqvlqevlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpe
    kfdperftpdgsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgq
    nlelvvtpsprpkdnlrvklhslm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve4B (B:)
    lpippgdfglpwlgetlnflndgdfgkkrqqqfgpifktrlfgknvifisgalanrflft
    keqetfqatwplstrillgpnalatqmgeihrsrrkilyqaflprtldsylpkmdgivqg
    yleqwgkaneviwypqlrrmtfdvaatlfmgekvsqnpqlfpwfetyiqglfslpiplpn
    tlfgksqraralllaelekiikarqqqppseedalgillaarddnnqplslpelkdqill
    llfaghetltsalssfclllgqhsdirervrqeqnklqlsqeltaetlkkmpyldqvlqe
    vlrlippvgggfreliqdcqfqgfhfpkgwlvsyqisqthadpdlypdpekfdperftpd
    gsathnppfahvpfggglreclgkefarlemklfatrliqqfdwtllpgqnlelvvtpsp
    rpkdnlrvklhs